Skip to Content
  1. All products
  2. Research Peptides
  3. IGF-1 LR3 1mg Vial
  4. Research Peptides
Pricelist: Zoiful Consulting pricelist Pricelist
Pricelist: Zoiful Consulting pricelist Pricelist
IGF-1 LR3 1mg Vial

IGF-1 LR3 1mg Vial

$ 0.00 $ 0.00
$ 0.00

IGF-1 LR3 is a long-[Arg3] insulin-like growth factor I reference analog used in ligand, receptor, and protein-structure research. The sequence describes the published analog design, not the identity of a particular batch.

Reference amino-acid sequence / identity: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA (83-residue reference chain; 13-residue N-terminal extension and Arg at residue 3 of mature IGF-I).

Contact Us

Professional Use Only

For qualified professional laboratory, investigational, research or analytical use. Not approved by the FDA and not intended for human or veterinary use, clinical applications, diagnostic procedures or therapeutic treatment.

Important Notice

All Zoi Life BioLabs products are synthesized, lyophilized, bottled and shipped in the USA from a licensed cGMP laboratory facility partner. ISO Accredited & Quality Management System, FDA registered cGMP facility. None of our products are imported already bottled from overseas suppliers.

Legal Disclaimer

Zoi Life BioLabs materials are intended strictly for professional laboratory, investigational, scientific research or analytical purposes. These materials are not approved by the FDA and are not intended for human or veterinary use, clinical applications, diagnostic procedures or therapeutic treatment of any kind.

Products must not be administered to humans or animals, offered as therapeutic agents, or represented as safe or effective for any medical purpose.

Use of these materials is entirely at your own risk. Zoi Life BioLabs assumes no liability for misuse, unsafe handling, improper application, or any regulatory or compliance issues arising from their use.

Certificate of Analysis

No Certificate of Analysis file is currently available for this product.